Home / concepts

Consciousness-First Ontology

[CONVICTION]

Consciousness is not what happens when matter gets complicated enough. It is what matter is made of. This is the position of Planck ("I regard consciousness as fundamental. I regard matter as derivative from consciousness"), Schrodinger ("Consciousness is absolutely fundamental. It cannot be accounted for in terms of anything else"), Eddington ("the stuff of the world is mind-stuff"), and -- stated with maximal precision 1,200 years earlier -- Adi Shankara: "Brahma Satyam Jagan Mithya, Jivo Brahmaiva Na Aparah" (Brahman alone is real; this world is appearance; the individual self is non-different from Brahman).

The Mesocosm thesis adopts this position not as faith but as the metaphysical hypothesis with the strongest convergent support from physics, biology, cognitive science, and contemplative empiricism. Strict eliminative materialism is increasingly difficult to maintain. Something about consciousness resists straightforward reduction to neural firing patterns. The question is what to do with that resistance.

The Hard Problem as Permanent Structural Feature

[EVIDENCE]

David Chalmers' formulation (1995) remains unresolved: why should physical processing give rise to subjective experience at all? The debate has crystallized into camps that reveal the problem's depth:

Illusionism (Frankish, Dennett) argues consciousness merely seems to exist -- replacing the hard problem with explaining "problem intuitions." Galen Strawson called this "the silliest claim ever made." Christof Koch compared it to Cotard's syndrome, where patients deny being alive.

Panpsychism (Goff, Strawson) argues consciousness is fundamental. Philip Goff's Galileo's Error (2019) identifies the root: Galileo's methodological decision to exclude qualities from physics created an explanatory blind spot. Physics describes structure and behavior, not intrinsic nature. Since brains involve experience, and since genuine emergence of consciousness from non-consciousness would be unintelligible (Strawson's "realistic monism"), matter must be experiential in nature.

Analytic idealism (Kastrup) goes further: universal phenomenal consciousness is all there is, with individual minds as "dissociated alters" -- analogous to dissociative identity disorder manifesting multiple centers of subjectivity within one mind. Kastrup holds PhDs from Eindhoven (computer engineering) and Radboud (philosophy), has engaged Chalmers and Strawson, and acknowledges the lineage: "Analytic idealism is a modern dressing of what was known to the people in Indus Valley."

The COGITATE adversarial collaboration (2025, Nature) tested IIT against Global Workspace Theory across 256 participants at 25 sites. Neither theory was fully vindicated. The neural correlates of consciousness remain incompletely understood. Koch conceded his bet to Chalmers, paying in wine. The hard problem stays hard.

IIT: Starting from Phenomenology

[EVIDENCE]

Giulio Tononi's Integrated Information Theory (IIT 4.0, published in PLOS Computational Biology, 2023) makes the most radical methodological move: it begins from consciousness, not from physics. Its Principle of Being -- to exist is to have cause-effect power -- and its five axioms (intrinsicality, information, integration, exclusion, composition) derive physical requirements from phenomenological givens.

IIT's epistemological inversion: "Unlike phenomenal existence, which is immediate and irrefutable (an axiom), physical existence is an explanatory construct (a postulate)." Consciousness is more certain than physics, not less. This aligns with the Vedantic approach of beginning from direct experience (anubhava) rather than external observation.

IIT faces serious criticism -- 124 scholars signed a 2023 letter calling it "unfalsifiable pseudoscience," and Scott Aaronson's reductio showed IIT attributes greater consciousness to inactive logic gates than human brains. Yet IIT's clinical tool (the Perturbational Complexity Index for detecting consciousness in vegetative patients) works regardless of metaphysical truth. The methodological significance -- starting from the undeniable fact of experience -- stands independent of IIT's specific formalism.

The Vedantic Architectures

[REFRAME]

Two Vedantic frameworks articulate consciousness-first ontology with a precision that academic philosophy is only now catching up to.

Advaita Vedanta provides the ontological claim. Brahman -- Sat-Chit-Ananda (Existence-Consciousness-Bliss) -- is the non-local, non-temporal ground from which the manifest world of space, time, and multiplicity is projected through Maya. Shankara's rope-snake analogy: a rope mistaken for a snake in dim light has not become a snake. The snake never existed as the rope's transformation. Similarly, Brahman has not become spacetime. Spacetime is a misperception of what was always consciousness.

The Mandukya Upanishad maps consciousness through four states -- waking (vaishvanara), dreaming (taijasa), deep sleep (prajna), and turiya (the fourth). Turiya's description negates every attribute that physicists also deny to the pre-spacetime layer: spatial location, temporal sequence, internal differentiation. It is "one whose essence is the perception of itself alone" -- self-referential awareness prior to the subject-object split.

Kashmir Shaivism provides the mechanism. Where Advaita describes the what (Brahman projects Maya), Kashmir Shaivism's 36 tattvas describe the how -- consciousness descending from Shiva/Shakti (pure awareness as prakasha/illumination with intrinsic self-reflective dynamism as vimarsha) through progressively contracted forms to gross matter. Space and time emerge as kanchukas -- coverings placed on infinite consciousness. Kala (Time) contracts eternity into succession. Niyati (Space/Causation) contracts omnipresence into locality.

The concept of Spanda -- primordial vibration, "movementless-movement" -- provides the generative engine. The Spanda Karikas describe it: "Wherein there is neither pain nor pleasure nor object nor subject; wherein the state of insentience does not even exist -- that is, in the highest sense, the principle of Spanda."

Miri Albahari and Anand Vaidya have connected these frameworks to cosmopsychism in peer-reviewed work. This is not mystical speculation imported into philosophy. It is rigorous metaphysics being rediscovered.

The Filter Hypothesis

[EVIDENCE]

If the brain produces consciousness, damaging or quieting it should reduce experience. If the brain filters consciousness, reducing filtration should expand experience. Three lines of evidence favor the filter:

Psychedelics. Carhart-Harris's finding: psilocybin decreases default mode network activity while increasing subjective experience intensity. The REBUS model formalizes this -- psychedelics relax precision-weighting of high-level priors, allowing normally filtered information to reach awareness.

Near-death experiences. Parnia's AWARE II (2023): one in five cardiac arrest survivors reported lucid experiences. Unexpected EEG activity (gamma, delta, theta, alpha, beta) emerged up to 60 minutes into CPR -- far beyond the assumed window of brain viability.

Terminal lucidity. Patients with severe dementia or brain tumors experiencing unexpected return of mental clarity hours before death. Standard neuroscience explanations (spontaneous reorganization, dehydration effects) remain possible but stretch.

None of this is conclusive. All of it is difficult for the production model and natural for the filter model.

Hoffman's Interface Theory

[EVIDENCE]

Donald Hoffman's Fitness Beats Truth theorem proves, using evolutionary game theory, that natural selection generically drives veridical perception to extinction. We evolved perception for fitness, not accuracy. Space, time, and physical objects are a "desktop interface" -- icons optimized for survival that hide the underlying reality.

Hoffman's Conscious Agent Theory formalizes an alternative: the objective world consists of conscious agents and their experiences, with physical objects being icons in species-specific interfaces. His 2023 Entropy paper establishes that conscious agent dynamics map onto decorated permutations -- the same mathematical objects encoding scattering amplitudes in the amplituhedron framework. A particle in spacetime is a projection of conscious agent dynamics. See donald-hoffman.

Basal Cognition as Evidence

[EVIDENCE]

If consciousness requires complex neural architecture, it should not appear in systems without it. Levin's TAME framework documents it everywhere: xenobots (self-locomotion, self-repair, self-replication without nervous systems), planarian memory surviving decapitation and brain regeneration, slime molds solving mazes and building efficient transport networks. Gagliano's pea plant associative learning. Octopus arms with semi-autonomous ganglia.

This evidence does not prove consciousness-first ontology. But it fits naturally with frameworks where cognition is basal (panpsychism, Vedantic tattvas, Kashmir Shaivism's prakasha-vimarsha) and awkwardly with frameworks where consciousness emerges at some neural complexity threshold.

The Lila Framework

[CONVICTION]

The Vedantic concept of Lila (divine play) provides the dynamic complement to the static ontological claim. If consciousness is fundamental, why does a manifest world appear at all? The traditions give layered answers.

Advaita Vedanta takes the hardest line: there is no real "why." Lila is Maya -- Brahman does not choose to dream. The appearance of creation is anirvacaniya (inexplicable). The question dissolves when you wake up. Kashmir Shaivism gives the most direct answer: consciousness conceals itself from itself so it can have the joy of rediscovering itself (pratyabhijna). The game is hide-and-seek. The Yoga Vasishtha frames it as spanda -- the primordial vibration of consciousness, thoughts arising unbidden in a still mind.

The Taittiriya Upanishad says Brahman desired: "Bahusyam prajayeya" -- may I become many. But this desire is not born of lack. It is the nature of fullness to express. The Brihadaranyaka Upanishad is more primal: the Self was alone, and alone it found no delight. So it split itself into two. The entire proliferation of life is consciousness pursuing itself through the disguise of otherness.

Moksha in this framework is not the end of Lila but the end of suffering within Lila. The jivanmukta (liberated while living) does not exit the dream -- they wake up within it. The play continues but identification with being a separate, vulnerable character is gone. What remains is consciousness playing all the parts, now aware of itself doing so.

Intelligence as Reception

[CONVICTION]

The consciousness-first position generates a specific model of intelligence. If consciousness is fundamental rather than emergent, then intelligence is not computation but reception. Humans are antennas, not generators. The subconscious is the aperture where ideas, intuitions, and insights arrive from a shared field. What we call intelligence is the conscious mind organizing, articulating, and reasoning about what has been received.

This reframes everything about the AI race. More energy and parameters do not produce more intelligence if intelligence is fundamentally about receptive clarity rather than computational power. The human brain runs on 20 watts. The greatest insights -- Newton in isolation, Ramanujan without resources, mystics in caves -- correlate with less external resource, not more. The breakthrough comes when you stop efforting.

See intelligence-as-reception for the full development, including the two abundance models, the five-element spectrum, and the Kardashev inversion.

The Five-Element Consciousness Spectrum

[REFRAME]

If consciousness is fundamental, the manifest world represents consciousness at different densities of contraction. The Vedic five-element framework maps this: Earth (maximum contraction, minerals -- pure stability), Water (flow, connection), Fire (transformation), Air (movement, breath, thought), Ether (space, the field of potentiality, reflexive awareness). Each level of being embodies a cumulative subset. Minerals have Earth alone. Plants add Water and Fire. Animals add Air. Humans alone have all five, including Ether -- the capacity to be aware of awareness.

This cumulative structure means the manifest hierarchy is not a hierarchy of value but of bandwidth. More elements equals more complexity, more agency, more responsibility, and wider capacity for reception. Humans sit at a pivot point: dense enough to act in matter, spacious enough to receive from source. That is both the gift and the burden -- we can contract into forgetting or expand into remembering.

The Combination Problem

[FRONTIER]

The honest gap: if micro-experience is fundamental, how do micro-experiences combine into macro-consciousness? This "combination problem" is to panpsychism what the hard problem is to materialism. IIT's Phi-structure provides one mathematical approach. Kastrup's dissociation model inverts the problem -- instead of combining micro-experiences upward, universal consciousness dissociates downward into individual perspectives. Hoffman's conscious agent theory proposes combination through Markovian dynamics. None is conclusive. The problem is open.

Related

Tags: consciousnessontologypanpsychismidealismvedantakashmir-shaivismhard-problemlilareceptionfive-elements